Total number of results for Penaeus monodon are 52
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00258 |
ANQYTFGL
|
8 | Penaeus monodon | Allatostatin | Allatostatin | 12126730#Duve H, Johnsen AH, Scott AG, Thorpe A#Allatostatins of the tiger prawn, Penaeus monodon (Crustacea: Penaeidea)#Peptides 2002 Jun;23(6):1039-51 | |
| NP00259 |
ASQYTFGL
|
8 | Penaeus monodon | Allatostatin | Allatostatin | 12126730#Duve H, Johnsen AH, Scott AG, Thorpe A#Allatostatins of the tiger prawn, Penaeus monodon (Crustacea: Penaeidea)#Peptides 2002 Jun;23(6):1039-51 | |
| NP00501 |
ANEDEDAASLFAFGL
|
15 | Penaeus monodon | Allatostatin | Allatostatin | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00502 |
SGHYNFGL
|
8 | Penaeus monodon | Allatostatin | Allatostatin A | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00679 |
HEEYQAHVQTV
|
11 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycaemic hormones | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00680 |
AHVQTVGK
|
8 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00717 |
DALSPPAAGLGADHSFT
|
17 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 1 | ||
| NP00718 |
SLFDPSCTGVFDRQLLRRLSRVCDDCFNVFREPNVATECRSNCYNNEVFRQCMEYLLPAHLHEEHRLAVQMV
|
72 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 1 | ||
| NP00719 |
RSLEGSSSPVASLIRGRSLS
|
20 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 2 | ||
| NP00720 |
ANFDPSCAGVYNRELLGRLSRLCDDCYNVFREPKVATECRSNCFYNPVFVQCLEYLIPADLHEEYQAHVQTV
|
72 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 2 | ||
| NP00721 |
RSFN
|
4 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 3 | ||
| NP00722 |
ANFDPSCAGVYNRELLGRLSRLCDDCYNVFREPKVATECRNNCFYNPVFVQCLEYLIPADLHEEYQAHVQTV
|
72 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 3 | ||
| NP00723 |
RSLDASPSSAFSGNHSLS
|
18 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 4 | ||
| NP00724 |
SLFDPACTGIYDRQLLGKLGRLCDDCYNVFREPKVATGCRSNCYYNLIFLDCLEYLIPSHLQEEHMEALQTV
|
72 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 4 | ||
| NP00725 |
ANFDPSCAGVYDRELLGGLSRLCDDCYNVFREPKVATECRSNCFYNSVFVQCLEYLIPADLHEEYQAHVQTV
|
72 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 5 | ||
| NP00745 |
AAQILRVAQGPSAFVAGPH
|
19 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00746 |
LINSILGLPK
|
10 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00747 |
LINSLLGIPKVMNDA
|
15 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00748 |
LINSLLGIPKVMTDA
|
15 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00749 |
LLGIPKVMNDA
|
11 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00750 |
NSELINSLLGIP
|
12 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00751 |
NSELINSLLGIPK
|
13 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00752 |
NSELINSLLGIPKVM
|
15 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00753 |
NSELINSLLGIPKVMNDA
|
18 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00754 |
NSELINSLLGIPKVMTDA
|
18 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00755 |
RSIAVVVL
|
8 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00756 |
RVAQGPSAFVAGPH
|
14 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00757 |
VAQGPSAFVAG
|
11 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP01558 |
GYRKPPFNGS
|
10 | Penaeus monodon | FMRFamide related peptide | SIFamide | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP01559 |
RKPPFNGSIF
|
10 | Penaeus monodon | FMRFamide related peptide | SIFamide | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP01901 |
GDRNFLRF
|
8 | Penaeus monodon | FMRFamide related peptide | FMRFamide-like neuropeptide FLP1 | 11959015#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Seven novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant tiger prawn Penaeus monodon.; #Comp. Biochem. Physiol. 131B:325-337(2002). | |
| NP01902 |
AYSNLNYLRF
|
10 | Penaeus monodon | FMRFamide related peptide | FMRFamide-like neuropeptide FLP2 | 11959015#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Seven novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant tiger prawn Penaeus monodon.; #Comp. Biochem. Physiol. 131B:325-337(2002). | |
| NP01903 |
AQPSMRLRF
|
9 | Penaeus monodon | FMRFamide related peptide | FMRFamide-like neuropeptide FLP3 | 11959015#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Seven novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant tiger prawn Penaeus monodon.; #Comp. Biochem. Physiol. 131B:325-337(2002). | |
| NP01904 |
SQPSMRLRF
|
9 | Penaeus monodon | FMRFamide related peptide | FMRFamide-like neuropeptide FLP4 | 11959015#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Seven novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant tiger prawn Penaeus monodon.; #Comp. Biochem. Physiol. 131B:325-337(2002). | |
| NP01905 |
SMPSLRLRF
|
9 | Penaeus monodon | FMRFamide related peptide | FMRFamide-like neuropeptide FLP5 | 11959015#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Seven novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant tiger prawn Penaeus monodon.; #Comp. Biochem. Physiol. 131B:325-337(2002). | |
| NP01906 |
DGRTPALRLRF
|
11 | Penaeus monodon | FMRFamide related peptide | FMRFamide-like neuropeptide FLP6 | 11959015#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Seven novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant tiger prawn Penaeus monodon.; #Comp. Biochem. Physiol. 131B:325-337(2002). | |
| NP01907 |
GYRKPPFNGSIF
|
12 | Penaeus monodon | FMRFamide related peptide | SIFamide | 11959015#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Seven novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant tiger prawn Penaeus monodon.; #Comp. Biochem. Physiol. 131B:325-337(2002). | |
| NP02069 |
QFDEYGHMRF
|
10 | Penaeus monodon | Gastrin/cholecystokinin | Sulfakinin-1 | 10672025#Johnsen AH, Duve H, Davey M, Hall M, Thorpe A#Sulfakinin neuropeptides in a crustacean#Isolation, identification andtissue localization in the tiger prawn Penaeus monodon Eur J Biochem 2000 Feb;267(4):1153-60 | |
| NP02070 |
AGGSGGVGGEYDDYGHLRF
|
19 | Penaeus monodon | Gastrin/cholecystokinin | Sulfakinin-2 | 10672025#Johnsen AH, Duve H, Davey M, Hall M, Thorpe A#Sulfakinin neuropeptides in a crustacean#Isolation, identification andtissue localization in the tiger prawn Penaeus monodon Eur J Biochem 2000 Feb;267(4):1153-60 | |
| NP02071 |
VGGEYDDYGHLRF
|
13 | Penaeus monodon | Gastrin/cholecystokinin | Sulfakinin-3 | 10672025#Johnsen AH, Duve H, Davey M, Hall M, Thorpe A#Sulfakinin neuropeptides in a crustacean#Isolation, identification andtissue localization in the tiger prawn Penaeus monodon Eur J Biochem 2000 Feb;267(4):1153-60 | |
| NP03910 |
RARPRF
|
6 | Penaeus monodon | NPY | Peptide tyrosine phenylalanine 1 | 12431727#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Panchan N., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Four novel PYFs: members of NPY/PP peptide superfamily from the eyestalk of the giant tiger prawn Penaeus monodon.; #Peptides 23:1895-1906(2002). | |
| NP03911 |
YSQVSRPRF
|
9 | Penaeus monodon | NPY | Peptide tyrosine phenylalanine 2 | 12431727#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Panchan N., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Four novel PYFs: members of NPY/PP peptide superfamily from the eyestalk of the giant tiger prawn Penaeus monodon.; #Peptides 23:1895-1906(2002). | |
| NP03912 |
YAIAGRPRF
|
9 | Penaeus monodon | NPY | Peptide tyrosine phenylalanine 3 | 12431727#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Panchan N., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Four novel PYFs: members of NPY/PP peptide superfamily from the eyestalk of the giant tiger prawn Penaeus monodon.; #Peptides 23:1895-1906(2002). | |
| NP03913 |
YSLRARPRF
|
9 | Penaeus monodon | NPY | Peptide tyrosine phenylalanine 4 | 12431727#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Panchan N., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Four novel PYFs: members of NPY/PP peptide superfamily from the eyestalk of the giant tiger prawn Penaeus monodon.; #Peptides 23:1895-1906(2002). | |
| NP04373 |
NFDEIDR
|
7 | Penaeus monodon | Orcokinin | Orcokinin | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP04374 |
NFDEIDRSGFDG
|
12 | Penaeus monodon | Orcokinin | Orcokinin | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP04375 |
NFDEIDRSGFGFV
|
13 | Penaeus monodon | Orcokinin | Orcokinin | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP04376 |
FDAFTTGFGHS
|
11 | Penaeus monodon | Orcokinin | Orcokinin-related peptide | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP04377 |
FTTGFGHS
|
8 | Penaeus monodon | Orcokinin | Orcokinin-related peptide | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP05598 |
APSGFLGMR
|
9 | Penaeus monodon | Tachykinin | Tachykinin-related peptide | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP05599 |
APSGFQGMR
|
9 | Penaeus monodon | Tachykinin | Tachykinin-related peptide | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP05600 |
PSGFLGMR
|
8 | Penaeus monodon | Tachykinin | Tachykinin-related peptide | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 |